PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa019225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 201aa    MW: 22287.4 Da    PI: 7.3915
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58671734PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-42451441100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+C ++C+lapyfp ++p+kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g+i +lq+ql+ l+aela++++e
  Lsa019225  45 PCAACKILRRRCIEKCMLAPYFPPTDPHKFTIAHRVFGASNIIKLLQELPESRRADAVSSMVYEANARLRDPVYGCAGTICQLQKQLSALQAELAKTQAE 144
                7**********************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.16244145IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4245142IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.1250.101.8E-4125183IPR012351Four-helical cytokine, core
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MEARLKTSVA AATSMNISTP TEESDYSNSH SPPSSPLAHP VVLSPCAACK ILRRRCIEKC  60
MLAPYFPPTD PHKFTIAHRV FGASNIIKLL QELPESRRAD AVSSMVYEAN ARLRDPVYGC  120
AGTICQLQKQ LSALQAELAK TQAEVVNLQC RQSNFLTLIR MQMDQQPPPV SPPQHQQTPN  180
YENASFFDDN ANLGSFEPLW T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057811.12e-80PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR06e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A103Y9H76e-89A0A103Y9H7_CYNCS; Lateral organ boundaries domain-containing protein
STRINGSolyc11g072470.1.11e-79(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-64LOB domain-containing protein 1